<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11113
Description |
Uncharacterized protein |
Sequence | MSTPPLSGPGMGAAAGPGGFPGAQAATAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTVTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLIPYVEEEYSKHDDRGIASQLRFASEEKREILEVNKKLKQKNQQLKQIMDQLRNLIWDINSMLAMRN |
Length | 184 |
Position | Head |
Organism | Xenopus laevis (African clawed frog) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Xenopus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.442 |
Instability index | 44.82 |
Isoelectric point | 8.44 |
Molecular weight | 20870.80 |
Publications | PubMed=27762356
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11113
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.25| 21| 73| 81| 101| 1
---------------------------------------------------------------------------
81- 101 (35.37/24.89) KLQEHLRQLSILFRKLR.LVYD
154- 175 (32.88/22.69) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|