<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11106
Description |
Uncharacterized protein |
Sequence | MAMLLNQAQPPQTRDGGGTQGASLGPGVPVGQQQLGLQQQQQDFDPVQRYRMLIPQLKESLQNLMKIAAQNLAQNTNIDNGQKSADGPVQRFDKSLEEFYALCDQMELCLRLAYECLSQSYDSAKHSPTLVPTATKPDAVQTESLPYTQYLSMIKSQISCAKDIHNALLECSKKIMGKTPNTQGGL |
Length | 186 |
Position | Tail |
Organism | Xenopus laevis (African clawed frog) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Xenopus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.520 |
Instability index | 54.28 |
Isoelectric point | 6.09 |
Molecular weight | 20430.03 |
Publications | PubMed=27762356
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11106
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.11| 18| 40| 33| 50| 1
---------------------------------------------------------------------------
33- 50 (33.78/20.02) QQLGLQQQQQDFD.PVQRY
74- 92 (28.34/15.74) QNTNIDNGQKSADgPVQRF
---------------------------------------------------------------------------
|