<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11104
Description |
Uncharacterized protein |
Sequence | MGVSAKRRPKVQPTTLALPPQYIDDVISRIDRMFPEMTIQLSRPNGSSAMLLLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDSCRQ |
Length | 136 |
Position | Tail |
Organism | Xenopus laevis (African clawed frog) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Xenopus.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.316 |
Instability index | 51.98 |
Isoelectric point | 9.55 |
Molecular weight | 15817.22 |
Publications | PubMed=27762356
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11104
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.62| 15| 26| 93| 108| 1
---------------------------------------------------------------------------
93- 108 (26.22/18.64) TWlRSYIKL..FQAPCQR
120- 136 (26.39/14.34) TW.RDFRTLeaFHDSCRQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.74| 14| 27| 25| 38| 3
---------------------------------------------------------------------------
25- 38 (25.19/16.01) DVISRID.RMFPEMT
54- 68 (20.55/12.05) DIWSKSNyQVFQKVT
---------------------------------------------------------------------------
|