<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11101
Description |
Uncharacterized protein |
Sequence | MSQQRILPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIDEEHQVSRPTQGEQDNYEMHVRSANIVRAGESLMKLVSDLKQFLILNDFPSVNESINQRKQQLRGLREECDKKLIALRDDIAIDLYELEEEYYSSSYSVCDQSDLPLCEVYWKRESTTSSPEDLSVPLAPIMAEASTVTSQIHTAPHLNGHGAEHT |
Length | 198 |
Position | Head |
Organism | Xenopus laevis (African clawed frog) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Xenopus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.648 |
Instability index | 66.54 |
Isoelectric point | 5.00 |
Molecular weight | 22671.17 |
Publications | PubMed=27762356
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11101
No repeats found
|