<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11093
Description |
Probable cyclin-dependent kinase E-1 |
Sequence | MSLTSNPPSSGGAGPSSANAQRTQTLKRSVQQAFDDPADRGLGPNVGYQSKVRVIDRYKVIGFISSGTYGRVYKACGRHGQTGEFAIKKFKPDKEGEQIQYTGISQSAVREMALCSELSHPSVIKLIEIILEDKCIFMVFEYAEHDLLQIIHHHTQPTRHPIPPSTVKSIMFQLLNGCQYLHANWVLHRDLKPANIMVTSSGEVKIGDLGLARLFNKPLHSLFSGDKVVVTIWYRAPELLLGSRHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVEIMGLPTKEKWPHLVNMPEYSQLSTLSTSSHPKSGSNLEKWYYSTINSHSATSNPSSNASLGAEGYKLLSGLLEYDPERRLTAQQALQHPFFSTGDKVSSNCFEGVKMEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDSRPVKRLKE |
Length | 440 |
Position | Kinase |
Organism | Phialocephala subalpina |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Mollisiaceae> Phialocephala>
Phialocephala fortinii species complex.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.450 |
Instability index | 40.40 |
Isoelectric point | 9.14 |
Molecular weight | 49159.52 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11093
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.21| 15| 33| 358| 373| 1
---------------------------------------------------------------------------
358- 373 (24.68/16.62) GYKLLS....GL.LEYdPERR
388- 407 (20.53/ 9.02) GDKVSSncfeGVkMEY.PHRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.57| 10| 27| 6| 15| 3
---------------------------------------------------------------------------
6- 15 (20.59/ 9.42) NPPSSGGAGP
35- 44 (19.98/ 8.97) DDPADRGLGP
---------------------------------------------------------------------------
|