Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MAQAHLTREDVKALQSTRQALFQLSNTIQSLKVDFLRTSTMPDWTTIQAQSGVVGNNVQSVTELLHKHADLLNRTVVFPSTNFPGRTQEGLLTQLLRKKLEPQVETWVEEGRTKGQTEETGGKSEEEFLLSARDWFTGRAAKYAGEEASLEYTFDEIENGVENVNTGLKPDDVSDDEDEEMADAGVAPGGSARSLEDILRFATTGNVMTNVSNGRR |
Length | 216 |
Position | Head |
Organism | Phialocephala subalpina |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Mollisiaceae> Phialocephala> Phialocephala fortinii species complex. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.605 |
Instability index | 43.09 |
Isoelectric point | 4.71 |
Molecular weight | 23878.09 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11090 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 82.38| 25| 50| 103| 127| 1 --------------------------------------------------------------------------- 103- 127 (42.58/22.93) QVETWVEEGRTKGQTEETGGKSEEE 156- 180 (39.80/21.03) EIENGVENVNTGLKPDDVSDDEDEE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ADAGVA 2) GSARSLEDILRFATTGNVMTNVSNGR | 182 190 | 187 215 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab