<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11085
| Description |
Related to cyclin-dependent kinase E-1 |
| Sequence | MSNATPPSTSSGPESVSGHRTQSIKRNLPATFEDPLDRGKARARIGYKCKTSILDSYSVVGFISSGTYGRVYKALGQPGHNLPGEFAIKKFKADKEGEKLAYTGISQSAIREMSLCSDLNHVNIIKLVETILEEKSIFMIFEYAEHDLLQIIHHHTQLPRQQIPPSMIKSIMFQLINGCRYLHSNWILHRDLKPANIMVTSSGVVKIGDFGLARCFHKPLQPLFSGDKVVVTIWYRAPELLLGSWHYDPAVDMWAVGCIFAELLALRPIFKGEEAKAESKRVPFQRSQMQKIIDILDMPTKDQWPLITSMPEYNQLSSLQPHLSQSSRAQNQKHQSPRSLSNQSNLDKWYYSITRANAGNDTSGSESLKALGVDGYKLLADLLEYNPERRLTAEQALGYPLLHVQSKVSMNCFDGLSIEYPHRRVKQDDTDIRPGSLPVMK |
| Length | 441 |
| Position | Kinase |
| Organism | Phialocephala subalpina |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Mollisiaceae> Phialocephala>
Phialocephala fortinii species complex.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.372 |
| Instability index | 47.19 |
| Isoelectric point | 8.99 |
| Molecular weight | 49654.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11085
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.38| 19| 316| 1| 28| 3
---------------------------------------------------------------------------
1- 19 (32.91/11.91) MSNATPPSTSSGPESVSGH
316- 334 (28.79/ 8.89) LSSLQPHLSQSSRAQNQKH
353- 367 (16.68/11.95) ITRANAGNDTSGSES....
---------------------------------------------------------------------------
|