<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11080
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MEQPQDAPALATAFPAPPPFWQSFTKENLERLKELRAVQTPPSKDYDAAKELPLRILDLPPELRLLQPPDQPADGKYRLYGDIYDLKTPLGSLQEQNVEQLYTPPGSPSGGSKAENFDRAFILKKLAKSLLLNFLELVGIMAVNPGQDPNAPPPPDGQERHLHAYEEKIGDLQTIFLNFHHLLNEYRPHQARESLILMMQDQLEKSKAETQGIREMKEKVEGILEGLSQAKLAEAVEMNGKGDQDDLDGQDVWAELEKEFD |
| Length | 261 |
| Position | Middle |
| Organism | Phialocephala subalpina |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Mollisiaceae> Phialocephala>
Phialocephala fortinii species complex.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.674 |
| Instability index | 44.98 |
| Isoelectric point | 4.75 |
| Molecular weight | 29401.89 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11080
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.71| 10| 18| 33| 42| 1
---------------------------------------------------------------------------
33- 42 (19.73/12.86) KE..LRAVQTPP
50- 61 (13.98/ 6.59) KElpLRILDLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.39| 21| 38| 68| 105| 2
---------------------------------------------------------------------------
68- 93 (28.13/16.65) PPdqPADGKYRlYGDIYDLKtpLGSL
152- 172 (43.26/17.05) PP..PPDGQER.HLHAYEEK..IGDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.79| 17| 20| 203| 219| 3
---------------------------------------------------------------------------
203- 219 (26.18/18.52) LEK.SKAETQGIREMKEK
224- 241 (20.23/12.63) LEGlSQAKLAEAVEMNGK
242- 258 (25.38/17.73) GDQ.DDLDGQDVWAELEK
---------------------------------------------------------------------------
|