Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEQPQDAPALATAFPAPPPFWQSFTKENLERLKELRAVQTPPSKDYDAAKELPLRILDLPPELRLLQPPDQPADGKYRLYGDIYDLKTPLGSLQEQNVEQLYTPPGSPSGGSKAENFDRAFILKKLAKSLLLNFLELVGIMAVNPGQDPNAPPPPDGQERHLHAYEEKIGDLQTIFLNFHHLLNEYRPHQARESLILMMQDQLEKSKAETQGIREMKEKVEGILEGLSQAKLAEAVEMNGKGDQDDLDGQDVWAELEKEFD |
Length | 261 |
Position | Middle |
Organism | Phialocephala subalpina |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Mollisiaceae> Phialocephala> Phialocephala fortinii species complex. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.674 |
Instability index | 44.98 |
Isoelectric point | 4.75 |
Molecular weight | 29401.89 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11080 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 33.71| 10| 18| 33| 42| 1 --------------------------------------------------------------------------- 33- 42 (19.73/12.86) KE..LRAVQTPP 50- 61 (13.98/ 6.59) KElpLRILDLPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 71.39| 21| 38| 68| 105| 2 --------------------------------------------------------------------------- 68- 93 (28.13/16.65) PPdqPADGKYRlYGDIYDLKtpLGSL 152- 172 (43.26/17.05) PP..PPDGQER.HLHAYEEK..IGDL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 71.79| 17| 20| 203| 219| 3 --------------------------------------------------------------------------- 203- 219 (26.18/18.52) LEK.SKAETQGIREMKEK 224- 241 (20.23/12.63) LEGlSQAKLAEAVEMNGK 242- 258 (25.38/17.73) GDQ.DDLDGQDVWAELEK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AKELPLRILDL 2) ELEKEF 3) FWQSFTKENLERLKEL 4) GKYRLYGDIYDLKT | 49 255 20 75 | 59 260 35 88 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab