<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11077
Description |
Probable RNA polymerase II holoenzyme cyclin-like subunit |
Sequence | MAANYWESTQRRHWQFTRQQLEDLRKKLEDEDQNLVQMYPLPQVRHLSIYFNQQIARLGKRLGVRQQAMATAQLYIRRFYSKVEIRRTNPYLVIATAVYLACKMEECPHHIRLVVSEGRTLWPDFFSSDTSKLGECEFFLISEMSSQMIVHHPYRSLTSLQGTFSLTQEESALAWSIINDHYMTDLPLLFAPHIIALMAILLALVLRPNTTGIQSAGGNAGTIASAAQTALSSAGQFKPTGEKQGATPRTKVQKLANWLAESNIDIEAIVDCTQEIISFYEVQEQYNEKLTREQINRFVKARGLDK |
Length | 306 |
Position | Kinase |
Organism | Phialocephala subalpina |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Mollisiaceae> Phialocephala>
Phialocephala fortinii species complex.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.286 |
Instability index | 55.63 |
Isoelectric point | 8.28 |
Molecular weight | 35016.69 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11077
No repeats found
No repeats found
|