Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASSHDVDMTGNQTPPPIPSEEPKYGGFTRFEIELEFVQSLASPLYLNHLAAMKYFENEAFVEYLKYLQYWSHPPYSKYLLYPGPTLKNLELLQVKEFRRDIISPDVVARLFEEGVKKGTEGPGS |
Length | 125 |
Position | Middle |
Organism | Phialocephala subalpina |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Mollisiaceae> Phialocephala> Phialocephala fortinii species complex. |
Aromaticity | 0.14 |
Grand average of hydropathy | -0.442 |
Instability index | 45.47 |
Isoelectric point | 5.16 |
Molecular weight | 14334.12 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11075 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 76.04| 20| 21| 37| 56| 1 --------------------------------------------------------------------------- 37- 56 (35.89/17.96) FVQSLASPLYLNHLAAMKYF 61- 80 (40.15/20.70) FVEYLKYLQYWSHPPYSKYL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KYGGFT 2) YSKYLLYP | 24 76 | 29 83 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab