<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11072
Description |
Mediator of RNA polymerase II transcription subunit 17 (Fragment) |
Sequence | LSGPQAFDKNEINSIQSTEGLLEKIIKQAKHIFLRSRSIQLQLNIGVEQVRVVHRDGRVIMLSHQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDSKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL |
Length | 199 |
Position | Head |
Organism | Mus musculus (Mouse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.268 |
Instability index | 61.18 |
Isoelectric point | 8.94 |
Molecular weight | 22358.48 |
Publications | PubMed=19468303
PubMed=21183079
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11072
No repeats found
|