Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAAVDVRDNLLGISWVDSAWIPILNNGSVLDYFSERSNPFYDRTCNNEVVKMQRMTLDHLNQMVGVEYILLHAQEPILFIIRKQQRQSPTQVIPLADYYIIAGVIYQAPDLGSVINSRVVTAVHGIQSAFEEAMSYCRYHPSKGYWWHFKDQEEREKAKPKAKKKEEPSSIFQRHRVDALLLDLRQKFPPRFVQQKPGEKPIPVDQIKKEPEPAPEAVKTEEKETVKNAQQSAAAKGPPEKRMRLQ |
Length | 246 |
Position | Head |
Organism | Gallus gallus (Chicken) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae> Phasianinae> Gallus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.597 |
Instability index | 48.64 |
Isoelectric point | 8.90 |
Molecular weight | 28338.17 |
Publications | PubMed=15592404 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central nucleoplasm GO:0005654 IEA:Ensembl |
GO - Biological Function | DNA binding GO:0003677 IEA:Ensembl transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central stem cell population maintenance GO:0019827 IEA:Ensembl |
Binary Interactions |
Repeats | >MDP11070 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.08| 21| 42| 148| 168| 1 --------------------------------------------------------------------------- 148- 168 (37.21/21.86) HFKDQEEREKAKP..KAKKKEEP 191- 213 (34.87/20.09) RFVQQKPGEKPIPvdQIKKEPEP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FQRHRVDALLLDLRQKFPPRFVQ 2) GEKPIPVDQIKKEPEPAPEAVKTEEKETVKNAQQSAAAKGPPEKRMRLQ | 172 198 | 194 246 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab