<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11063

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMSPTISLHKLVKVLASKKTSPKVFGSLLKQLLSTTEVSDNEMVESLIEIPKGSDPVQQKYLVDYAVEFACGSISDLQRFMSLLVQASVESQRTYVVFFKNSYSRVFRLNALKEFIQSGYIPYTVRFMSNLAEVVELDSIQKSTLTHILFLWGDIIDNHSEMIPSGPFKEMAISVMSNLVKFGYDSLSGYFTKKANVLMTTADLNKELQPGVPLVPLGAENNEKLTMSMVQKSFSVNWHSKKAATYLIIKKFMWLNTQFEQWQIHNLVDDYLQFFGISTHKLSELVDEIVSAFFGGITIAILLKEMPYVIFNWRNFIVSTLPIFLKNSRHIHSAISSENLGELLCDAVVKRKDTAITQMAVGDKPYDLRKHFLRNCIYQKIITLEEFTKLFPEEADALSLSLIIHETEQLSHLDSLTSELNNKLLEVNTEFTSLEESRLIEYFQSLPKTNILFLEKKQKQLNKLAHKAVDALVKDKSSEKLGRLLIAMANTPTVSNIIFFQDPLGPWGLLNKLILYLDQESFRVDEDDSNFQDTYAYFGVILSGIIAIVVHFNIDFKLAEVKDSYTINFITRFFYRHCEDLTAKVVGSDEDDSTIVANYNTLLQDWVNALFDVNNEGLSDDLIKSINVKQTYKLITIIFQQAITANILGTLSTSGLNNGLDYLSQNFLAPCSLEIMEWILSGIGPLQPNSEAMVSIFLRIMEINLGNSGTTSDPNYTFRVLLCIVGPRALEKLQTLKNWRNFEAAARSVSILKRELGHDHLTPQNANILQVGSFDLVQTIKQCLIHYVREPGNYSVLTTWANIRWWWSKLSGPQTFDAFLQELHQCLVLHNHVDVEESKVFLDFLVFLVVATSGVKEESSSTGTGNEIDMGHRESATVSDKFSLTIDNHYSSIFNEVAGFVPESEKPPKDNLMGDFEMDDLFNDAGDDLFGDNGLHASAPFTKKQHSLPAVDTVYKTLKGADGKYTCIEQMLIGRGGGGKNRITGIAKLKLAQELEHAHRR
Length1000
PositionTail
Organism[Candida] intermedia
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
Aromaticity0.10
Grand average of hydropathy-0.068
Instability index39.51
Isoelectric point5.60
Molecular weight112878.02
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11063
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     130.53|      43|      55|      64|     117|       1
---------------------------------------------------------------------------
   64-   99 (24.21/37.60)	......................YAVefacgsisdlqRF.MSLLVQA....SVE.SQRTYVVFFK
  100-  151 (58.48/41.65)	NSYSRVFRLNALKEFIQSgyipYTV...........RF.MSNLAEVveldSIQkSTLTHILFLW
  156-  189 (47.84/32.55)	DNHSEMIPSGPFKEMAIS....................vMSNLVKF....GYD.SLSGY.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.87|      21|      56|     276|     307|       2
---------------------------------------------------------------------------
  286-  307 (31.40/23.64)	DEIVSAFFGGITiAILLKEMPY
  345-  365 (35.48/13.65)	DAVVKRKDTAIT.QMAVGDKPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     112.27|      46|      57|     407|     455|       3
---------------------------------------------------------------------------
  390-  451 (58.87/44.88)	FPEEadalslsliihetEQLSH..LDSL....TSELNNKLLEVNTEFTSLeeSRLIeYFQ......SLPKTNIL
  452-  514 (53.39/30.95)	FLEK........kqkqlNKLAHkaVDALvkdkSSEKLGRLLIAMANTPTV..SNII.FFQdplgpwGLLNKLIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     119.21|      36|      56|     637|     673|       5
---------------------------------------------------------------------------
  637-  673 (56.64/45.54)	IFQQAITANILGTLSTSGLNNGLDYLsQNFLAPCSLE
  695-  730 (62.57/45.45)	IFLRIMEINLGNSGTTSDPNYTFRVL.LCIVGPRALE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.77|      32|     251|     552|     602|       8
---------------------------------------------------------------------------
  524-  570 (39.94/71.13)	DEDDSNFqdtYAYFGVILsgiiaivvhfNID......FKLAEVKDSYtiNFIT
  588-  635 (40.83/20.30)	DEDDSTI...VANYNTLLqdwvnalfdvNNEglsddlIKSINVKQTY..KLIT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11063 with Med5 domain of Kingdom Fungi
Unable to open file!