Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MADDLISSLYPPPPPYFKYFTDDNVTKFEEWKKTESEGLPKGELSLQVPPEVPLGDQYRGYGSIWALENKLPSLKELGWRQLYNDHDETITSKQKIDELHKLLDSLLLNFLELVGLMSVEPAKFYVKVEDLKLILININHLLNTYRPHQTRESLIMLLKKQIESKKAEILEIDKVTAEVKEKILGLVLNGEIAHLQERRNDISESGEHEEQMKKLQLLRELMEEQKK |
Length | 227 |
Position | Middle |
Organism | [Candida] intermedia |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.543 |
Instability index | 49.02 |
Isoelectric point | 5.31 |
Molecular weight | 26436.15 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11054 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.92| 15| 31| 95| 109| 1 --------------------------------------------------------------------------- 95- 109 (24.27/14.17) KIDELHKLLDSL..LLN 127- 143 (18.65/ 9.44) KVEDLKLILINInhLLN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.26| 12| 36| 8| 19| 2 --------------------------------------------------------------------------- 8- 19 (27.43/16.78) SLYPPP..PPYFKY 45- 58 (19.83/10.46) SLQVPPevPLGDQY --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKLQLLR 2) PYFKYFTD | 213 15 | 219 22 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab