| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADDLISSLYPPPPPYFKYFTDDNVTKFEEWKKTESEGLPKGELSLQVPPEVPLGDQYRGYGSIWALENKLPSLKELGWRQLYNDHDETITSKQKIDELHKLLDSLLLNFLELVGLMSVEPAKFYVKVEDLKLILININHLLNTYRPHQTRESLIMLLKKQIESKKAEILEIDKVTAEVKEKILGLVLNGEIAHLQERRNDISESGEHEEQMKKLQLLRELMEEQKK |
| Length | 227 |
| Position | Middle |
| Organism | [Candida] intermedia |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.543 |
| Instability index | 49.02 |
| Isoelectric point | 5.31 |
| Molecular weight | 26436.15 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP11054
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.92| 15| 31| 95| 109| 1
---------------------------------------------------------------------------
95- 109 (24.27/14.17) KIDELHKLLDSL..LLN
127- 143 (18.65/ 9.44) KVEDLKLILINInhLLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.26| 12| 36| 8| 19| 2
---------------------------------------------------------------------------
8- 19 (27.43/16.78) SLYPPP..PPYFKY
45- 58 (19.83/10.46) SLQVPPevPLGDQY
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KKLQLLR 2) PYFKYFTD | 213 15 | 219 22 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab