<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11053
Description |
CIC11C00000000061 |
Sequence | MADRLTQLQVCLDQLVAQFNATINYVNTQSDLAPLDADPNSVINVAANAPLPGKKDQENSEANSAPSGSAPQAPFEVVINELSTDIILKSRQISMIIDSLPGIGTLPETQLKIINDLINELEQTEKDRCAKIKEKDELLKWCEDLIVDVSGGIYRTRT |
Length | 158 |
Position | Middle |
Organism | [Candida] intermedia |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.255 |
Instability index | 30.16 |
Isoelectric point | 4.40 |
Molecular weight | 17305.39 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11053
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.48| 15| 15| 21| 35| 1
---------------------------------------------------------------------------
21- 35 (25.88/16.48) ATINYVNTQSDLAPL
37- 51 (25.60/16.24) ADPNSVINVAANAPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.68| 19| 33| 63| 82| 2
---------------------------------------------------------------------------
63- 82 (29.58/24.14) NSAPS.GSAPQAPFEvVINEL
98- 117 (29.09/18.69) DSLPGiGTLPETQLK.IINDL
---------------------------------------------------------------------------
|