<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11041
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MAVTAVYFVAAAHNAPGVAELTDRLIRAFDPVPAGNWGLHHRSFRSTPQNTTDKSPPHFQHVLALGHYPDRAFVHIAGPDQQQDQQQQDHQQQQQPSTVAIPLQQMEQYSQLLSLKFGALWMYRMGSQVGVGASYSVGEFTVRLGELREKGGQNALRGTVVCIQTAKQESRPDEGEAPSARIDADEELQAGQALVRDVWSRFSVPQFKETITSRPAAPEADDQLFDEVRLWCEALRFQK |
| Length | 239 |
| Position | Head |
| Organism | Diplodia corticola |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetes incertae sedis> Botryosphaeriales> Botryosphaeriaceae>
Diplodia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.526 |
| Instability index | 51.69 |
| Isoelectric point | 5.74 |
| Molecular weight | 26677.48 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11041
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.37| 14| 40| 170| 183| 2
---------------------------------------------------------------------------
170- 183 (25.57/14.36) SRPDEGEAPSARID
213- 226 (25.79/14.53) SRPAAPEADDQLFD
---------------------------------------------------------------------------
|