<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11033
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDHSAATPPSNVPTAIPQLKKIPKNPPPTTTVSATAKGTSGAAASQQPQQPATPAAAEAQAQQQESPPTEPTPDTPEIFALRQRELARDLIVKEQQIEYLISVLPGVGSSETEQEERIGRLAEELRAVEAERMVKRREMRRLGERIDELLGAVEGRG |
| Length | 186 |
| Position | Middle |
| Organism | Blastomyces percursus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.547 |
| Instability index | 60.79 |
| Isoelectric point | 5.07 |
| Molecular weight | 20326.67 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11033
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.56| 24| 43| 35| 59| 1
---------------------------------------------------------------------------
35- 59 (41.28/22.01) ATPPSNVPTAiPQLKKIPKNPPPTT
81- 104 (43.29/19.62) ATPAAAEAQA.QQQESPPTEPTPDT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.29| 15| 18| 122| 136| 2
---------------------------------------------------------------------------
122- 136 (24.76/19.05) KEQQIEYLISVLPGV
143- 157 (23.52/17.73) QEERIGRLAEELRAV
---------------------------------------------------------------------------
|