<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11032
Description |
Rna polymerase ii holoenzyme cyclin-like subunit |
Sequence | MSASYWSSSQRRFWTYTKPELAQIRRSLEDENKELVQKYPLPDRRLLHIYFCSQLSKLVRRLKLSQQAVATAQVYIRRVYTKIEIRRTNSNLVILTALYLACKMEESPQHIRVILGEARQAWQDIILPDTSKLGECEFSLISEMNSQLIIHHPYRSLLDLQASFKLTHEEYAQAEYVINDHYLTDLPLLHPPHVIAIAAMVVAVTLGPTQAGINMLTAANMQSAMSGLAQQQTGTGGASPVKMQHLMNWLADSTVDIEAVADCVQEMVSLYEVWEQYNEKICKDQVNRFIKARGLEK |
Length | 297 |
Position | Kinase |
Organism | Diplodia corticola |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetes incertae sedis> Botryosphaeriales> Botryosphaeriaceae>
Diplodia.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.201 |
Instability index | 55.51 |
Isoelectric point | 7.12 |
Molecular weight | 33981.81 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11032
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.97| 20| 23| 203| 225| 1
---------------------------------------------------------------------------
206- 225 (34.56/31.70) LGPTQAGINMLTAANMQSAM
228- 247 (35.41/22.74) LAQQQTGTGGASPVKMQHLM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.54| 20| 23| 128| 147| 2
---------------------------------------------------------------------------
128- 147 (35.65/23.49) PDTSKLG.ECEFSLISEMNSQ
153- 173 (30.89/19.57) PYRSLLDlQASFKLTHEEYAQ
---------------------------------------------------------------------------
|