Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAQGNPHKPPIPHLENPRFTLELEFVLSLANPHYISHLAVTYPHLLGTSASSSSSSSRAAEDGSPFTPSSDAQSFAAYLAYLYSYWKRPEYVQFLTHPGATLRALRLLQDESFRQAVIRPQVIEALLGAGAEDGASGGAGAGDNRNDKDARNEPEAVKMAGLIGPEGRNGIET |
Length | 173 |
Position | Middle |
Organism | Emergomyces pasteurianus Ep9510 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Emergomyces. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.392 |
Instability index | 52.55 |
Isoelectric point | 5.64 |
Molecular weight | 18589.43 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11015 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.50| 13| 30| 88| 100| 1 --------------------------------------------------------------------------- 88- 100 (25.40/15.97) RPEYVQFLTHPGA 119- 131 (22.10/13.12) RPQVIEALLGAGA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 32.23| 8| 23| 5| 14| 2 --------------------------------------------------------------------------- 5- 14 (14.16/15.08) NPHKppIPHL 31- 38 (18.07/ 9.66) NPHY..ISHL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AQSFAAYLAYLYSYW 2) EAVKMAGLI | 72 155 | 86 163 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab