<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11013
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MASISPEQLKVLEQTRQRLVHLTQSLASLINNINQSDPLPSWSSLQSQATIISNNLLNVSEQLTDHHDLLSSLVAYPTPQFPGRTEAAMLSQLLRTKLEPRVEDWVSQGLSMGSADATRRRTGLTVEQLTELWQWAPVEANMEARKRNWGGDYTLEEKEMGVKNVVTGLKRRLNEEDSGSESGSGDEDETGEGAEEGGEGSGMEVVGVHRRAGGGGVQFDISSEGGHVPPAPMSHALPLQDVFKFMMTGAVPRGR |
| Length | 255 |
| Position | Head |
| Organism | Blastomyces percursus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.529 |
| Instability index | 61.55 |
| Isoelectric point | 4.99 |
| Molecular weight | 27786.67 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11013
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.88| 12| 15| 175| 187| 1
---------------------------------------------------------------------------
175- 187 (18.33/11.47) E.EDSGSEsGSGDE
192- 204 (17.55/ 6.64) EgAEEGGE.GSGME
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 74.59| 17| 17| 70| 86| 2
---------------------------------------------------------------------------
70- 86 (31.57/17.54) LSSLVAYPTPQFPGRTE
90- 103 (21.98/10.45) LSQLLR..TKLEP.RVE
110- 125 (21.04/ 9.76) LSMGSADATRRRTGLT.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.34| 16| 21| 24| 39| 4
---------------------------------------------------------------------------
24- 39 (28.08/18.07) QSLASLINN..INQSDPL
46- 63 (22.25/13.21) QSQATIISNnlLNVSEQL
---------------------------------------------------------------------------
|