<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11009
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAAQSAVPLEEITWRSPLHVQTMGGFLHSNNILFYFAESPFFDQTSNNASLAIQANYNENFRPFIETREAFEGRLKTMQGLEFMVVHDPLQEAAAAAAGGKQQRKQQEVSNIWVIRKQMRKKRTGMGSGAAGGDDEIQVLATYFVVGDSVFMAPSVLKVVGSRMLSTVTSLTRALSVASPLPIFSPSYGHTYMPPVPKSLEASRPGVQQSGQQSIANTPMPDASSQSKGGSVLSATGSTQQPSASAFPLASSSSTTQDSRSFVEAFNLLSRYGDEYMDDAPLLGEPGSFIIGKTSTEPLVVGMRQPMRSKVSKAPTPAPSAGARPGGNKPGTPAATGAAAAPPAIKTDAATLGAGKAGRGGEKSPTTPGGGKERLKRRKSKISSVAVASLAAGSSAGSS |
| Length | 399 |
| Position | Head |
| Organism | Blastomyces percursus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.290 |
| Instability index | 59.25 |
| Isoelectric point | 9.76 |
| Molecular weight | 41643.53 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11009
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.92| 13| 15| 313| 325| 1
---------------------------------------------------------------------------
313- 325 (25.95/12.94) KAPTPAPS.AGARP
329- 342 (18.97/ 7.39) KPGTPAATgAAAAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.21| 13| 15| 233| 245| 3
---------------------------------------------------------------------------
218- 238 (16.49/ 6.66) TPMPDASsqskggsvLSATGS
239- 254 (16.72/ 6.85) TQQPSAS.....afpLASSSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.48| 31| 68| 279| 312| 4
---------------------------------------------------------------------------
279- 312 (48.54/31.01) DAPLLGePGSFIIG..KTSTEPlvVGMRQPM...RSKVS
348- 383 (44.95/20.61) DAATLG.AGKAGRGgeKSPTTP..GGGKERLkrrKSKIS
---------------------------------------------------------------------------
|