Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAAQSAVPLEEITWRSPLHVQTMGGFLHSNNILFYFAESPFFDQTSNNASLAIQANYNENFRPFIETREAFEGRLKTMQGLEFMVVHDPLQEAAAAAAGGKQQRKQQEVSNIWVIRKQMRKKRTGMGSGAAGGDDEIQVLATYFVVGDSVFMAPSVLKVVGSRMLSTVTSLTRALSVASPLPIFSPSYGHTYMPPVPKSLEASRPGVQQSGQQSIANTPMPDASSQSKGGSVLSATGSTQQPSASAFPLASSSSTTQDSRSFVEAFNLLSRYGDEYMDDAPLLGEPGSFIIGKTSTEPLVVGMRQPMRSKVSKAPTPAPSAGARPGGNKPGTPAATGAAAAPPAIKTDAATLGAGKAGRGGEKSPTTPGGGKERLKRRKSKISSVAVASLAAGSSAGSS |
Length | 399 |
Position | Head |
Organism | Blastomyces percursus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.290 |
Instability index | 59.25 |
Isoelectric point | 9.76 |
Molecular weight | 41643.53 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11009 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.92| 13| 15| 313| 325| 1 --------------------------------------------------------------------------- 313- 325 (25.95/12.94) KAPTPAPS.AGARP 329- 342 (18.97/ 7.39) KPGTPAATgAAAAP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 33.21| 13| 15| 233| 245| 3 --------------------------------------------------------------------------- 218- 238 (16.49/ 6.66) TPMPDASsqskggsvLSATGS 239- 254 (16.72/ 6.85) TQQPSAS.....afpLASSSS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 93.48| 31| 68| 279| 312| 4 --------------------------------------------------------------------------- 279- 312 (48.54/31.01) DAPLLGePGSFIIG..KTSTEPlvVGMRQPM...RSKVS 348- 383 (44.95/20.61) DAATLG.AGKAGRGgeKSPTTP..GGGKERLkrrKSKIS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AATGAAAAPPAIKTDAATLGAGKAGRGGEKS 2) TTPGGGKERLKRRKSKISSVAVASLAAGSSA | 334 366 | 364 396 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab