<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10988
Description |
Uncharacterized protein |
Sequence | MADILTQLQTCLDQVFPARPTAKHKSKTQNQKLYLTKVKPFRIQLATQFYATLCYLSTYHDHSAATPPPNVPTAIPQLKKIPKNPPPATSASAAEKAAGRTAASPQPQQPNTPAAADAELPAEPTPDSPEIFAQRQRELARDLIVKEQQIEYLISVLPGVGSSEAEQEERIRQLAEELRIVEAERRVKRKEMRKLGERVDELLGAVEGRG |
Length | 210 |
Position | Middle |
Organism | Emergomyces pasteurianus Ep9510 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Emergomyces.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.615 |
Instability index | 51.78 |
Isoelectric point | 8.83 |
Molecular weight | 23250.24 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP10988
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.80| 16| 17| 105| 120| 1
---------------------------------------------------------------------------
76- 96 (18.63/ 6.14) PQlkkiPKNP.PPAtsASAAEK
105- 120 (30.88/14.35) PQ....PQQPNTPA..AADAEL
124- 139 (28.29/12.61) PT....PDSPEIFA..QRQREL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.29| 10| 18| 167| 176| 3
---------------------------------------------------------------------------
167- 176 (15.82/10.71) QEERIRQLAE
188- 197 (16.47/11.41) KRKEMRKLGE
---------------------------------------------------------------------------
|