Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAPIDKPDHNLVEQQIKDVIQDLFQVMVQVSTYDQAGKPSREVLSSELSTLSTSLRAVHRTAASSLPPNDNTSTSLPLIPDPLIEYVEAGRNPDIYTREMVELVRRMNQLARGKEMAFVRFRDVLAGEMGRAMPELAGDVDRVLEATGGREPIAGVVAEGGGGGGGREGEGGSGGEGEKK |
Length | 180 |
Position | Middle |
Organism | Coniochaeta ligniaria NRRL 30616 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Coniochaetales> Coniochaetaceae> Coniochaeta. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.421 |
Instability index | 34.44 |
Isoelectric point | 4.87 |
Molecular weight | 19273.47 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10985 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 49.82| 14| 14| 138| 151| 1 --------------------------------------------------------------------------- 138- 151 (24.47/12.27) GDVDRVLEATGGRE 155- 168 (25.35/12.95) GVVAEGGGGGGGRE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LIPDPLIEY 2) REGEGGSGGEGEKK | 78 167 | 86 180 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab