Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSTLSLDADEFRTLESLRQRLATLTANLKSLQDNIARSNPLPTPSSLQASARIAQQNLFSLHNLLTDRQDLFARLAVHPSTNFPGREHEMILQNILRKKLEPDVEGWVEECRDTAVRAGVEVSKSGKVGKRRGEEEEEEEEEDEEGYRPEDEDDVGGDPLTDLWADVRDALMGRITEFVEGESQDVYTVEEREMGVENVRTGLKRDLEEEEEESEDEDEEGEKVDEDEDVVMLGPGGAPAAKPPVAQSQNQGPRVEPEHVLWFGVRGDFSLPGNIETETTRKARAGAGRRGGPGR |
Length | 295 |
Position | Head |
Organism | Coniochaeta ligniaria NRRL 30616 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Coniochaetales> Coniochaetaceae> Coniochaeta. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.892 |
Instability index | 67.72 |
Isoelectric point | 4.46 |
Molecular weight | 32904.62 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10980 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 71.33| 13| 37| 101| 113| 1 --------------------------------------------------------------------------- 101- 113 (26.39/10.25) EPDVEGWVEECRD 141- 153 (24.83/ 9.29) EEDEEGYRPEDED 204- 216 (20.10/ 6.38) KRDLEEEEEESED --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.47| 20| 36| 18| 37| 4 --------------------------------------------------------------------------- 18- 37 (32.52/26.47) RQRLATLTANLKSLQDNIAR 55- 74 (34.95/28.97) QQNLFSLHNLLTDRQDLFAR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAKPPVAQSQNQGPRVEPEHVLWFGVRGDFSL 2) NIETETTRKARA | 240 274 | 271 285 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab