<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10966

Description Uncharacterized protein
SequenceMWFPNTKASVIRKGGNGNGLVAVAIDKDNKGSRHALKWAADSLLTRGQTLVLIHVLHTKSTLVSSGGREAIICNSNSPAPDASPQREELVSITKDLFHTFHCYCTRKDIQCLDVLLEDTDVVKGITEYVSYAAIENLVLGAASRHGFIRFKSSSKPSSIAKGSPDFCTVYVISKGKISSVRSASRAAPHASPLLKDIQNLNNENNPKISSSRHMTMGSRDHHRTSIKPHSWQDESIKSQIGKRIGLSGRSCMDYSESDTDISFVSSERPSTSTGRSSSVYTDYIDSGRNSRTSTSSDRSLGTGFMFTDLTSQDLSFSKESSLTSSSYSYQNMDEAEVDMRRLRLELKQMMEMYGAACKEALTAQQKLMELNNQRTDEEKKVDEARLAQEAALATAEKEKARSRAAMETIEVATKVVEMESSRKMNVKTEALKEAEEMRKLLNDVAEAGERYKKYTIEEIEIATDSFSESRKIGEGGYGPVYKCYLDDIPVAVKVLRPDSTQGKSQFQKEVDILSCMNHPNMVFLLGACPEHSILIYEYMENGSLEDCLFRNKDENLMSWQLRFQIAAEIATGLLFLHETKPEPLVHRDLKPSNILLDHNYVSKISDVGLARILPVVAENVTQCHMTSAAGTFCYIDPEYQQTGTVGVKSDVYSLGIILLQLLTGRPPMGLAYQVGESIENDKFVEMLDKSVPEWPLEEALCLAKVAVKCVELRRKDRPDLGKEVLPELQKLREFAEDIMSPITDFFGEDSSSEPSPSQSHASMQQDVMSEPRCGGVHQTQASRFFKTSGLSSRVCGYGSLTLGLNNGQLAAAIRFLFKDKTGCGASFQ
Length828
PositionTail
OrganismLupinus angustifolius (Narrow-leaved blue lupine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus.
Aromaticity0.07
Grand average of hydropathy-0.403
Instability index46.21
Isoelectric point6.03
Molecular weight91748.91
Publications
PubMed=27557478

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP10966
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.38|      19|      47|     406|     424|       1
---------------------------------------------------------------------------
  406-  424 (31.94/22.83)	METIEVATKVVEMESSRKM
  456-  472 (26.11/17.27)	IEEIEIATD..SFSESRKI
  485-  501 (21.33/12.70)	LDDIPVAVKVLRPDSTQ..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     106.09|      29|      29|     151|     179|       2
---------------------------------------------------------------------------
  121-  144 (17.60/ 6.77)	........VVKGIT...EYVSYAAIENlvlGAASR
  151-  179 (49.01/31.50)	KSSSKPSSIAKGSP...DFCTVYVISK...GKISS
  181-  210 (39.48/23.99)	RSASRAAPHA..SPllkDIQNLNNENN...PKISS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      78.44|      20|      22|     263|     284|       3
---------------------------------------------------------------------------
  265-  284 (38.03/19.29)	SSERPS.TSTGRSSSVYTDYI
  286-  305 (21.58/13.04)	.SGRNSrTSTSSDRSLGTGFM
  317-  331 (18.83/ 6.80)	SKESSL.TS...SSYSYQN..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.04|      16|      51|     375|     399|       5
---------------------------------------------------------------------------
  359-  374 (25.77/28.35)	EALTAQQ.KLMELNNQR
  383-  399 (19.27/ 9.11)	EARLAQEaALATAEKEK
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP10966 with Med32 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) SPLLKDIQNLNNENNPKISSSRHMTMGSRDHHRTSIKPHSWQDE
191
234

Molecular Recognition Features

MoRF SequenceStartStop
NANANA