Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MARSKAIASNASSTFPDPPPFWRDFTTDKIDRMESLRSRYADQTGLDISTIIRVPDVPDDLTNLQPPAEPADGKWRLFGEQLTLNDKLQSLEAAGIERLVPSEDDLDGKHVDRAFVLKRLAKSLLLNFLELMGVMGIAPEQGHEKVQDIRTLLLNFHHILNEYRPHQAREQLIALMQDQLDAKRAETAAIRAVVDKAKRVLEGLGSIELPPDGSISTPEMGMQPVNSVQAKNHTRVQEEQRRAREQAGWAALDSDFP |
Length | 257 |
Position | Middle |
Organism | Coniochaeta ligniaria NRRL 30616 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Coniochaetales> Coniochaetaceae> Coniochaeta. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.505 |
Instability index | 48.15 |
Isoelectric point | 5.34 |
Molecular weight | 28803.30 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10965 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.13| 17| 74| 155| 171| 2 --------------------------------------------------------------------------- 127- 145 (25.78/17.26) NFLELMGvmGIAPEQGHEK 155- 171 (32.35/23.38) NFHHILN..EYRPHQAREQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWRDFTTDKID 2) LRSRYA | 21 36 | 31 41 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab