<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10963

Description Uncharacterized protein
SequenceMEVQGQERLNQAVQQQLNLEQVKTRALSLFKSISRILEDFDAYGRTNTTPKWQDILGQYSMLNLELFNIVDEIKKVSKAFIVHPKNVNAENATVLPVMLSSKLLPEMELDDNSKRDQLLQNNISIDKLKARIDMIAAACEGAEKVLADTRKAYCFGTRQGPTTFAPTLDKGQAAKIYDQENLLRAAVNVGDGLRIPPDQRHIVAPLTSLPIHLQQALTVHHHDPPFSSNNMSAQNAFLQATGSQLLGRSAASPSAATSATSFDNTASPIPYANSPRSSTNIMNTPSPQQQTQQQQTPPQQQQQQLQQQQRQKLVQLPQQQQQQLLAQQKQFRQSAIQGMGQLHGQHQMQFSQSLGHQQFQGRQLSTGHVQHNIAQSQLNQGNQMTRLSQFSGPANSALFSAAQITPNSQMLPNMSDTMPSQTLLPRMQFGLSGNNPQRSHASQMLSDQMYNMGGGNPGGMMPIQQQQQQQQHGSQGGAFGSMASNAQNLQSGMVTLQNTQQNHPNFSQQRQQNPQ
Length515
PositionHead
OrganismLupinus angustifolius (Narrow-leaved blue lupine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus.
Aromaticity0.05
Grand average of hydropathy-0.711
Instability index57.95
Isoelectric point9.39
Molecular weight56979.19
Publications
PubMed=27557478

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10963
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.94|      18|      18|     294|     311|       1
---------------------------------------------------------------------------
  300-  318 (29.07/ 6.43)	QQQQQLQQQQRQkLVQLPQ
  498-  515 (29.88/ 6.78)	NTQQNHPNFSQQ.RQQNPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     222.59|      78|     146|     214|     347|       2
---------------------------------------------------------------------------
  214-  299 (121.77/68.99)	QQALTVHHHDppFSSNNMSA...QNAFLQA...TG......SQLlgrSAASPSAATSATSFDNTASPIPYANS........PR.....SSTN........................IMntPSPQQQtQQQQTPPQ
  349-  475 (100.82/25.40)	QFSQSLGHQQ..FQGRQLSTghvQHNIAQSqlnQGnqmtrlSQF...SGPANSALFSAAQITPNSQMLPNMSDtmpsqtllPRmqfglSGNNpqrshasqmlsdqmynmgggnpggMM..PIQQQQ.QQQQHGSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.42|      18|      35|      19|      36|       3
---------------------------------------------------------------------------
   19-   36 (28.09/25.86)	LEQVKTRALSLFKSISRI
   56-   73 (30.33/28.63)	LGQYSMLNLELFNIVDEI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10963 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FLQATGSQLLGRSAASPSAATSATSFDNTASPIPYANSPRSSTNIMNTPSPQQQTQQQQTPPQQQQQQLQQQQRQKLVQLPQQQQQQLLAQQKQFRQSAIQGMGQLHGQHQMQFSQSLGHQQFQGRQLSTGHVQHNIAQSQLNQGNQMTRLSQFSGPANSALFSAAQITPNSQMLPNMSDTMPSQTLLPRMQFGLSGNNPQRSHASQMLSDQMYNMGGGNPGGMMPIQQQQQQQQHGSQGGAFGSMASNAQNLQSGMVTLQNTQQNHPNFSQQRQQNPQ
237
515










Molecular Recognition Features






MoRF SequenceStartStop




NANANA