<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10958
| Description |
Uncharacterized protein |
| Sequence | MDSEGKKFGGGPRELTGAVDLISQFKLLPHFEFFCKKPLPVSVADTHYLHNVVGDTEIRKGDGMQVDQLIQNTSSFRETSARIQPFDLDILKEAFQLRETGPIDLPPGEKGISTIAGKSKGESKDKEKKHKKHKDRDKEHKKHKHHHKDRSKDKDKDRDKKKDKSGHRDSSADHSKKHHDKVEKF |
| Length | 185 |
| Position | Head |
| Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
genistoids sensu lato> core genistoids> Genisteae> Lupinus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.318 |
| Instability index | 23.46 |
| Isoelectric point | 9.43 |
| Molecular weight | 21162.61 |
| Publications | PubMed=27557478
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10958
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.49| 19| 19| 126| 144| 1
---------------------------------------------------------------------------
126- 144 (34.35/11.21) KEKKHKKHKDRDKEHKKHK
146- 164 (33.14/10.62) HHKDRSKDKDKDRDKKKDK
---------------------------------------------------------------------------
|