| Description | Uncharacterized protein |
| Sequence | MDFEGKSFGRGHKELGGAHDLISQYKLWPYYQFFCKRSHPASISETHYLRNVVGDTKIRKGEGMELDQLRRNASMREKETCLHPFDLDVLSEAFHMKEMNPIRLSSAQKGLATPVSKSVNQCRHKEDKDRKDKDKNRKGEKHTRHKPHQVKDGSCIENNRICPKDSHPSQLKIQLDKKRKAEISNDRSVSKRLSIRKLDAGL |
| Length | 202 |
| Position | Head |
| Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.113 |
| Instability index | 39.39 |
| Isoelectric point | 9.68 |
| Molecular weight | 23376.40 |
| Publications | PubMed=27557478 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP10955
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.15| 23| 46| 39| 61| 2
---------------------------------------------------------------------------
39- 61 (40.40/29.41) HPAS...ISETHYLR..NVVGDTKIRKG
83- 110 (31.76/21.74) HPFDldvLSEAFHMKemNPIRLSSAQKG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) QLKIQLDKKRK 2) RLSIRKLDAGL | 170 192 | 180 202 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab