Description | Uncharacterized protein |
Sequence | MDFEGKSFGRGHKELGGAHDLISQYKLWPYYQFFCKRSHPASISETHYLRNVVGDTKIRKGEGMELDQLRRNASMREKETCLHPFDLDVLSEAFHMKEMNPIRLSSAQKGLATPVSKSVNQCRHKEDKDRKDKDKNRKGEKHTRHKPHQVKDGSCIENNRICPKDSHPSQLKIQLDKKRKAEISNDRSVSKRLSIRKLDAGL |
Length | 202 |
Position | Head |
Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.113 |
Instability index | 39.39 |
Isoelectric point | 9.68 |
Molecular weight | 23376.40 |
Publications | PubMed=27557478 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10955 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.15| 23| 46| 39| 61| 2 --------------------------------------------------------------------------- 39- 61 (40.40/29.41) HPAS...ISETHYLR..NVVGDTKIRKG 83- 110 (31.76/21.74) HPFDldvLSEAFHMKemNPIRLSSAQKG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QLKIQLDKKRK 2) RLSIRKLDAGL | 170 192 | 180 202 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab