<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10951
| Description |
Uncharacterized protein |
| Sequence | MDSEGNKFGGGPRELTSAVDLISHFKLQPHFEFFCKRPLPVSIADTHYLHNVVGDTEIRKGDGMQLDQLIQNTSSFRDTSARIQPFDLDILKEAFQLRETGPIDLPPGEKGIPTIAGKSKSGSKDKEKKHKKHKDRDKDKDKEHKKHKHRHKDRSKDKDKDKDKKKDKSGHRDSSADHSKKHHDKKRKHDGDDDINDVHKHKKSKHKSSKIDELGAIRVAG |
| Length | 221 |
| Position | Head |
| Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
genistoids sensu lato> core genistoids> Genisteae> Lupinus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.448 |
| Instability index | 31.57 |
| Isoelectric point | 9.56 |
| Molecular weight | 25232.03 |
| Publications | PubMed=27557478
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10951
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 89.64| 19| 19| 124| 142| 1
---------------------------------------------------------------------------
118- 139 (29.96/ 8.24) KSKsgsKDKEKKHKKHKDRDKD
140- 155 (29.54/ 8.02) KDK......EHKKHKHRHKDRS
178- 194 (30.14/ 8.33) HSK...KHHDKKRKH..DGDDD
---------------------------------------------------------------------------
|