<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10946
| Description |
Uncharacterized protein |
| Sequence | MSSYGPDEGPSSTGWRVHHWVSMQQAVLHPIFLKLLLVLVEPFGWSFLVGAPRGAAQDSIVLIADFHSLLSSQLRQQLKHTGRWKDEMPMRLGRQFWICKVGCYWEGVESTLIHSSALVPDPGKHP |
| Length | 126 |
| Position | Tail |
| Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
genistoids sensu lato> core genistoids> Genisteae> Lupinus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.070 |
| Instability index | 34.22 |
| Isoelectric point | 7.89 |
| Molecular weight | 14202.27 |
| Publications | PubMed=27557478
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10946
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.18| 11| 20| 37| 48| 1
---------------------------------------------------------------------------
37- 48 (15.26/16.23) LVLVEPFGwSFL
60- 70 (18.91/11.78) IVLIADFH.SLL
---------------------------------------------------------------------------
|