<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10939
| Description |
Uncharacterized protein |
| Sequence | MLFEPLGPRELTGAVDLISHYKLLPHFEFFCKKPLPVSIADTHYLQYVVGDTEVRKGDGMQLDQLIQNTSSFRDTSARIQPFDQDILKEAFQLKETGPIDLPPGEKGIPTIAGKSKSESKDKEKKHKRHKDRDKDKDKEHKKHKHRHKDRSKDKDKDKKKDKSGHRDSSADHSKKHHDKKRKHDGDDDLNDVHKHKKSKHKSSKIDEMGAIRVAG |
| Length | 215 |
| Position | Head |
| Organism | Lupinus angustifolius (Narrow-leaved blue lupine) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
genistoids sensu lato> core genistoids> Genisteae> Lupinus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.400 |
| Instability index | 30.95 |
| Isoelectric point | 9.49 |
| Molecular weight | 24770.70 |
| Publications | PubMed=27557478
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10939
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 100.78| 15| 15| 121| 135| 1
---------------------------------------------------------------------------
121- 135 (31.34/12.84) DKE.KKH...K.RHKDRDKD
137- 153 (21.84/ 6.64) DKEhKKH...KhRHKDRSKD
155- 169 (24.80/ 8.57) DKD.KKK...D.KSGHRDSS
171- 188 (22.80/ 7.27) DHS.KKHhdkK.RKHDGDDD
---------------------------------------------------------------------------
|