<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10936

Description Uncharacterized protein
SequenceMEVSGGRGWEEEVVELTKVAQEKESDPLVWAIQMHSNLNSAGESLPSIELAELLVSYICWDNNVPILWKFLDKALMLQIVPPMLLLALLSLRVIPCRHVQPAAYRLYLELLKRHAFELKSQTNRPDYPRVMKSIDDVLHLSQVFGMSQSEPGILVVEFIFSIVWQLLDASLDDEGLLELTLEKKSMWETLYQEMELDWHDNFNDKKTEHHEKLRNANALLTIEMIGQFLQDKISSRILYLARRNLPAHWLSLVQRVQLLGENSLILRNSRVLSPEALLQLTSDTSMALSRECKTSSQHKFHTVMDFEYLSSSASLCHGASHSALWIPLDLVLEDAMDGYEVSATSAIEIIGGLIKTLQAINGTSWHDTFLGLWLATLRLIQRERDPIEGPMPHLDTRLCMLLCIIPLVVADLIEEEEEEERRQVDETETDSDPTNNWKEKKVPGKCRNNLVTSLQVLGDYHSLLTPPQSVVAAANQAAAKAMLFVSGFTIGNAYFDCLSMTEIPIDCSGNMRHLLVEACIARNLLDTSAYLWPGYVKGRMNQIPQCMPAQLPSWSSFMDGAPLNSAMVNALASSPATSLAELEKIFEIAIGGSEDQKISAAAVLCGASLIRGWNIQEYTAHFILRLLSPPVPLENTEGNNHLIDYAPILNVIFVGIASVDCVQIFSLHGLVPQLACSLMPICEVFGSCVPNISWTLTSGEEISAHAVFSNAFILLLKLWKFNRPPLEHGIGDVPTVGSQLTPEYLLLVRNSHLMSDGNIHKDRNKKRLSEIASLSSPNSVFVDSFPKLKVWYRQHQACIASTLSGLVHGTPFHQIVDGLLNMMFRNISRGDQVTIVSGSSSSSGPENEDTSIGTKLPAWDILEAIPFVVDAAVTACAHGRLSPRELATGLKELADFLPASLATIISYFSAEVTRGVWKPVFMNGTDWPSPAANLLNVEEQIKKMLAATGVDVPSLAPGGSSPATLPLPLAAFTSLTITYKVDRASERFLNLAGQTLESLAAGCPWPSMPIVASLWTQKAKRWSDFLIFSASRTVFLHNRDAVVQLLKSCFTATLGINSSPISSSGGVGALLGHGFKSHFCGGMSPVAPGILYLRVYRSIRDVVFLTEEIVSILMQSVREIVSGGPSRERLQKSKATKDGIKYGQVSLATAMTQVKLAAALGASLVWLSGGLVLVQLLIKETLPSWFISVHRSGQEENSDGMVAMLGGYALAYFAVLCGAFAWGVDSSSSASKRRPKVLGVHMEFLASALDGKISLGCDSATWRAYVSGFVSLMVSCTPNWVLEVDVDVLKRLSNGLRHLNEEKLALALLGDGGVGTMGAAAELIIESGR
Length1329
PositionTail
OrganismLupinus angustifolius (Narrow-leaved blue lupine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus.
Aromaticity0.07
Grand average of hydropathy0.130
Instability index46.06
Isoelectric point5.60
Molecular weight145619.36
Publications
PubMed=27557478

Function

Annotated function 
GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
regulation of phenylpropanoid metabolic process	GO:2000762	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10936
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.20|      15|     124|     386|     400|       1
---------------------------------------------------------------------------
  386-  400 (31.73/20.67)	PIE..GPMPHLDTRLCM
  504-  520 (24.46/14.17)	PIDcsGNMRHLLVEACI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     123.18|      43|     601|     687|     737|       6
---------------------------------------------------------------------------
   67-  109 (75.75/42.27)	LWKFLDKALMLQI..VPPMLLLALLSLRVIPCRHVQPAAYRLYLE
  692-  717 (32.09/20.78)	...................ISWTLTSGEEISAHAVFSNAFILLLK
  718-  736 (15.34/ 8.92)	LWKFNRPPLEHGIgdVPTV..........................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.02|      12|     601|     602|     616|       7
---------------------------------------------------------------------------
  602-  616 (19.94/17.56)	AVLCGASlirGWNIQ
 1214- 1225 (25.08/13.37)	AVLCGAF...AWGVD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10936 with Med33 domain of Kingdom Viridiplantae
Unable to open file!