<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10930

Description Uncharacterized protein
SequenceMDSDNLRSILECSGVDVWSFIDTAITVAATDSGEELKRRRDAIVERLYSAVNAPLSCRNCEVGGNRSVVTANQVKKHISPSRSPKRQPQQRRFVSSPETPQSLENDNENDNDLDPYGGLFEDEQKKILEIKEQLEEPEQSEDSLVDLLQNLEDMDITFQALTETDIGRHVNVLRKHSSNDVRKLVKLLVKKWKEIVDEWVKSNPHGETSTLMGDGDSPPLHKTTQSGHHQIPDFAYSPNPHNGSSGSDRNEGELKSKVIPRRREAPTPSPSLHTPAPSALQIRQREQRESNFDAERLSSATKRLQANYKEAENAKKQRTIQVMDIHELPKSKSKNTFFGKNKGSAGSQGRHW
Length352
PositionUnknown
OrganismLupinus angustifolius (Narrow-leaved blue lupine)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> genistoids sensu lato> core genistoids> Genisteae> Lupinus.
Aromaticity0.05
Grand average of hydropathy-0.981
Instability index64.25
Isoelectric point6.44
Molecular weight39660.54
Publications
PubMed=27557478

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP10930
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.23|      27|      43|      97|     123|       1
---------------------------------------------------------------------------
   97-  123 (49.44/33.59)	PE.TPQSLENDNENDNDLD.PYGGLFEDE
  137-  165 (36.79/23.22)	PEqSEDSLVDLLQNLEDMDiTFQALTETD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.78|      31|     222|      31|      61|       2
---------------------------------------------------------------------------
   31-   61 (55.37/34.19)	DSGE.ELK.....RRRDAIV..ERLYSAVNAPLSCRNCE
  248-  286 (38.41/21.69)	DRNEgELKskvipRRREAPTpsPSLHTPAPSALQIRQRE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     109.17|      30|      34|     180|     209|       3
---------------------------------------------------------------------------
  180-  209 (51.98/31.06)	DVRKLVKLLVKKWKEIVDEWVKSNPHGETS
  216-  245 (57.19/34.80)	DSPPLHKTTQSGHHQIPDFAYSPNPHNGSS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP10930 with Med26 domain of Kingdom Viridiplantae

Unable to open file!