<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10926
Description |
Mediator of rna polymerase ii transcription subunit 22b |
Sequence | MHKQQVQAADTLLKLVSELKQTTIFSGFASLNDHAEQRTEEFTEQAEKTKCMLSRIGEEAVGCLKELESHYYSSAERTSSLYSYSQETMP |
Length | 90 |
Position | Head |
Organism | Nicotiana attenuata (Coyote tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.649 |
Instability index | 64.95 |
Isoelectric point | 5.10 |
Molecular weight | 10226.28 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10926
No repeats found
No repeats found
|