<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10921
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASTPNPETDESAKSASSPQKSVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNPTFRNAMAHPANKEVAHRQQFYFWKNYRNNRLKHILPRPLPEPATAPATTAPLSVAPPAAPPPAPSPVSAVALSPMQCAIPPGSGLAKTDPRSGTVDRRKRKKDG |
| Length | 202 |
| Position | Middle |
| Organism | Nicotiana attenuata (Coyote tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.609 |
| Instability index | 60.82 |
| Isoelectric point | 9.32 |
| Molecular weight | 22947.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10921
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.71| 18| 18| 134| 151| 1
---------------------------------------------------------------------------
134- 151 (33.89/12.43) PRPLPEPATAPATTAPLS
154- 171 (33.82/12.39) PPAAPPPAPSPVSAVALS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.56| 16| 18| 64| 79| 2
---------------------------------------------------------------------------
40- 58 (23.45/14.44) FVQC...LanpTYIHYLAQNRY
64- 79 (32.73/22.78) FIGY...L...KYLQYWQRPEY
82- 100 (23.38/14.38) FIMYphcL...FFLELLQNPTF
---------------------------------------------------------------------------
|