Description | Mediator of RNA polymerase II transcription subunit 10 (Fragment) |
Sequence | NSSAAGSIGSNRIINPIYKYASPANAAATTADSPAEDLKQNLNQSINSIENTLGILHQLYLTVSSYNVSSQLLLIQRLNNLVLELDNMAKFGEKCNIQVPMDVLNLTDNGKNPDEFTRDVLNNCIVKNQITKGKTDAFNGLRRHLLEELEQTFPDEVEAYREIRAASAAGADVAFGLRI |
Length | 179 |
Position | Middle |
Organism | Nicotiana attenuata (Coyote tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.280 |
Instability index | 37.52 |
Isoelectric point | 5.04 |
Molecular weight | 19622.82 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10918 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 43.49| 14| 15| 80| 93| 1 --------------------------------------------------------------------------- 80- 93 (23.29/13.93) NLVLELD..NMAKFGE 96- 111 (20.19/11.33) NIQVPMDvlNLTDNGK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AYREIR 2) SSAAGSIGSNRIINPIYKYASPANA | 159 2 | 164 26 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab