Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MLQNVPHQLLQSPARLGLPTPSSPSVQNPNPPPKFSSQVSQPNQPLQQANILTTTTTSSTLLPLLPPLSRAQSLLIQMASLASRLFEVSPNGSHWLSAFRGSFPSFLPSATPVPQDSFPSSSKEILSVFTSLQTQLFEAVAELQEILDLQDEKQKVIREIRSKDSSILAFANKLKEAERVLDMLVDDYSDYRRPKRAKLENDTEESSVTTVATQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYNFADLDVGLPKLDEGKEKIIEPLIEPPAETNPLANIQGLITPNIVVPSGWKPGMPVELPSDLPFPPPGWKPGDPIALPPFDSLPLHPKVEEAPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSDEASSDSED |
Length | 399 |
Position | Middle |
Organism | Nicotiana attenuata (Coyote tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.399 |
Instability index | 77.85 |
Isoelectric point | 4.74 |
Molecular weight | 43649.85 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10913 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 105.57| 29| 32| 310| 338| 1 --------------------------------------------------------------------------- 310- 338 (60.09/25.27) PSGWKPGMP.VELPSDLPFPPPGW.KPGDPI 342- 372 (45.48/17.27) PFDSLPLHPkVEEAPARPVPPPGLpRMPEPI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 93.68| 26| 33| 6| 33| 2 --------------------------------------------------------------------------- 6- 33 (46.57/30.85) PHQLLQSPARLGLPTPSSPSVqnPNPPP 42- 67 (47.11/25.08) PNQPLQQANILTTTTTSSTLL..PLLPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 153.02| 38| 39| 214| 251| 3 --------------------------------------------------------------------------- 163- 206 (37.20/14.35) ..KDSSILAFANKLkeaervldmlvdDYSDYRRPK....RAKLENDT..EES 214- 251 (64.56/29.02) QLKLSDILSYAHRI............SYTTFAPPEFGAGQAPLRGAL..PPA 256- 291 (51.26/21.89) QMRASQLYNFAD................LDVGLPKLDEGKEKIIEPLiePPA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 64.51| 20| 32| 90| 110| 4 --------------------------------------------------------------------------- 90- 110 (34.96/22.76) PNGS.HWLSAFRgSFPSFLPSA 119- 139 (29.55/14.36) PSSSkEILSVFT.SLQTQLFEA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EAPARPVP 2) PGLPRMPEPIQVRHVQLDIEDDSSDYS | 354 363 | 361 389 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab