<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10908
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQNVQHQLLQSPARLGLPTPSSPSLQNPIAPPKFSSQVSQHLQPHQQANILTTTTTSSTLLPLLPPLSRAQCLLIQMSSLSSRLFEVSANRSHWLSAFRGSFPSFLPSAAPVPQDSYPSSSKEIFSVFTSLQTQLFEAVAELQEILDLQDEKQKVTREIRSNDSAILAFANKLKGAERVLDNLVDDYSDYRRPKRVKLENDIDESSVTTVATQLKLSDILSYAHRISYTTFAPPEFGAGRAPLRGALPPAPQDEQMRASQLYNFANLDVGLPKTDDDKEKIIEPLIEPSADITNLSAIPGLIPPNIIVPSGWKPGMPVELPTDLPLPPPGWKPGDPIALPPVDSLPLPPKVEEAPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSEASSDSED |
| Length | 398 |
| Position | Middle |
| Organism | Nicotiana attenuata (Coyote tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.361 |
| Instability index | 76.07 |
| Isoelectric point | 4.89 |
| Molecular weight | 43546.78 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10908
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 110.37| 18| 18| 312| 329| 1
---------------------------------------------------------------------------
235- 251 (23.37/ 6.75) P......EFGAGrAP..LRG.A.LPPA
312- 328 (32.89/12.39) .......GWKPG.MPVELPT.D.LPLP
329- 349 (27.69/ 9.31) P.....pGWKPG.DPIALPPvDsLPLP
350- 371 (26.43/ 8.56) PkveeapA.RPV.PPPGLPR...MPEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.55| 12| 15| 178| 189| 3
---------------------------------------------------------------------------
178- 189 (21.34/14.32) ERV.LDNLVDDYS
195- 207 (16.21/ 9.34) KRVkLENDIDESS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 108.11| 33| 77| 22| 60| 4
---------------------------------------------------------------------------
22- 60 (48.89/36.75) SSPSLQnPIAPPkfssqVSQHLQPHQQANILTTTTTSST
102- 134 (59.21/29.88) SFPSFL.PSAAP.....VPQDSYPSSSKEIFSVFTSLQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.21| 14| 15| 276| 289| 5
---------------------------------------------------------------------------
276- 289 (24.33/12.52) DDDKEKIIEPLIEP
292- 305 (24.88/12.96) DITNLSAIPGLIPP
---------------------------------------------------------------------------
|