<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10900

Description Mediator of rna polymerase ii transcription subunit 36a
SequenceMVAPTRGRGGGGFRGGRGDGGGRGGRGGRGGFGGGRGGGGSAMKRGGGRGGGGRGGGGRGGGRGGRGGGFKGGNKVMVEPHRHGGVFIAKGKEDALCTKNLVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKLAAAVLGGVDDIWIKPGAKVLYLGAASGTTVSHVSDLVGPGGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKAGGHFVISIKANCIDSTVPAEAVFAQEVKKLQAEQFKPMEQVTLEPFERDHACVVGAYRVPKKQKAGA
Length314
PositionUnknown
OrganismNicotiana attenuata (Coyote tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.07
Grand average of hydropathy-0.330
Instability index32.00
Isoelectric point10.14
Molecular weight32665.91
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
methyltransferase activity	GO:0008168	IEA:UniProtKB-KW
RNA binding	GO:0003723	IEA:UniProtKB-KW
GO - Biological Process
methylation	GO:0032259	IEA:UniProtKB-KW
rRNA processing	GO:0006364	IEA:UniProtKB-KW

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP10900
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.81|      18|      25|      17|      40|       1
---------------------------------------------------------------------------
   17-   39 (30.90/15.12)	RgdGGGRGGrGGRGgfGGGRGGG
   45-   62 (44.90/ 8.28)	R..GGGRGG.GGRG..GGGRGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.69|      15|      17|     195|     211|       2
---------------------------------------------------------------------------
  195-  211 (21.96/27.84)	AKKR.....TNVipIIEDARHP
  212-  231 (20.73/16.22)	AKYRmlvgmVDV..IFSDVAQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     191.06|      57|     161|      82|     141|       4
---------------------------------------------------------------------------
   82-  141 (91.01/96.62)	RHGGVFIAKGKedALCTKNLVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKlAAAVLG
  246-  302 (100.04/91.29)	KAGGHFVISIK..ANCIDSTVPAEAVFAQEVKKLQAEQFKPMEQVTLEPFERD.HACVVG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP10900 with Med36 domain of Kingdom Viridiplantae

Unable to open file!