Description | Mediator of rna polymerase ii transcription subunit 15a |
Sequence | MREMYVPKLNDLYQKIAAKVQQHDSLPQRPQTEQIEKLKVFKMTLERVVVFLRLNKHDIQPSHKEKLLQVEKHISFFLNSNRPHKPTPTLQGQLPQPSMQLQQPQYLDGQGNPLMQHVQAEMIRQSCKHRRLRRGAVEEVSPVGSHDDCAEDDQKKLDEEQKD |
Length | 163 |
Position | Tail |
Organism | Nicotiana attenuata (Coyote tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.991 |
Instability index | 66.80 |
Isoelectric point | 8.85 |
Molecular weight | 19119.69 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro transcription coactivator activity GO:0003713 IEA:InterPro |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP10896 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) DDQKKLDEEQK 2) ISFFL | 152 74 | 162 78 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab