<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10888
| Description |
Mediator of rna polymerase ii transcription subunit 15a |
| Sequence | MDGKNWKAQSRAQARAQARARARARGGGEGTALSAAPAGGLRASVDPTAQTRYANGADWQEEVYQKIKSMKEMYLPKLNDLYHKVASEVQQCPQHEKIEKFKVFKLKLEYFVLLLQLNKHDIQLYDKEKLLSVEKHINFFLKSNNPPQPDSSLLQGQLPQPPVYTSQTPMMGSGWQDIASHFYRLDDSSYGLGSKQNSFGIATSGFDRLGSSSGANLVEERLGMVEERLEKIEAHSKKAEALLTDINKKMNYPVKIRYVKVSRDIRCPAKYMNCHFRPKRKNRSGSRASIDD |
| Length | 292 |
| Position | Tail |
| Organism | Nicotiana attenuata (Coyote tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.736 |
| Instability index | 44.48 |
| Isoelectric point | 9.61 |
| Molecular weight | 33026.25 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10888
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.22| 15| 110| 128| 142| 1
---------------------------------------------------------------------------
128- 142 (24.92/20.27) EKLL.SVEKHINFFLK
240- 255 (20.30/15.18) EALLtDINKKMNYPVK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.12| 17| 21| 172| 191| 2
---------------------------------------------------------------------------
174- 191 (31.08/30.90) GWQD....IA.SHFYRLDDSSyG
193- 214 (22.04/ 8.75) GSKQnsfgIAtSGFDRLGSSS.G
---------------------------------------------------------------------------
|