<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10880

Description U-box domain-containing protein 35
SequenceMIYEVQSRSIMPAFNYIRSPSRIKRALSWKETFITEEEWQNMEENDISKTEGQGTMQSPPSSVVAIAISGNKNSKYVVKWALDKFVPEGETRFMLLHARPEITAVPTPMGNLIPIAQVREDVADAFRKEVELQASEKLLPYKTMFIRRKVQVGVVQIESNDVVNAIAGIVSKCSINKLVIGTSTPGLFSRGRNLSASISETAPTFCTVYAVSKGKLSSVRPSSYENNGAVIDDSSDTSSSSNNSTGQSFSSQAERTDHSSTSPASYSHLYSPSRKLQRYQSKSPTHHALQTLLHKRTNIGETIQSRSSSIDIGEAFQALSIKNNTKRANLNEVIHPRAMTIAIGEAEDDKSCYFSSSGITDPNSLTSSFKKAKVDNQQWSTSQSSNSDAPTDSSSGSQVNINYDLEKLRIELRHIQGMYAIAQTEAIDASRKLNEFQKLRVDEANKLMEINLKEEEAKELAEQEKLKCEAAKKEADYAMECAEREVEKRRAAESIANREARTKEKLEKSLVLPLNHYQEFTWEEIVTASSSFSEDLKIGMGSYGMVYKCYLHHTTAAVKVLYSAEAHRTKQFQQELEILSTIHHPHLLILLGACPARGCLVYEYMENGSLEDRLIRKNNTPPLTWFDRVRIAWEVASALVFLHYTKPKPIIHRDLKPANILLDHNLVSKIGDVGLSTMLQSDSSSAMTAYKDTSPVGTLCYIDPEYQRTGLVSTKSDVYAFGMVILQLLTAKRAIALAHMVEMAIEDDNLVKLLDREAGEWPIEETKELAVLAIKCTELRRRDRPDLKDEVLPALERLKEVADRARDLIYIRSPSPSHFKCPLLKEVMQDPCVAADGYTYDRKAIESWLKDNDHSPVTNSPLPHKQLLANYTLLSAIKEWKSGKH
Length885
PositionTail
OrganismNicotiana attenuata (Coyote tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.07
Grand average of hydropathy-0.447
Instability index52.38
Isoelectric point6.67
Molecular weight99227.46
Publications









Function






Annotated function

Functions as an E3 ubiquitin ligase.



ECO:0000256	ARBA:ARBA00003861

GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10880
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.69|      19|      24|     428|     451|       5
---------------------------------------------------------------------------
  428-  446 (29.50/23.49)	DASRKLNEFQKLRVDEANK
  455-  473 (29.18/11.87)	EEAKELAEQEKLKCEAAKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.63|      28|      41|     195|     224|       6
---------------------------------------------------------------------------
  195-  224 (43.06/36.89)	SASISETAPTFCTvyAVSKGKLSSVRPSSY
  239-  266 (48.57/33.95)	SSSNNSTGQSFSS..QAERTDHSSTSPASY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.45|      16|     793|       4|      21|       7
---------------------------------------------------------------------------
    4-   21 (26.09/23.58)	EVQSRSimPAFNYIRSPS
  800-  815 (29.36/18.82)	EVADRA..RDLIYIRSPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.23|      24|      24|     345|     368|       8
---------------------------------------------------------------------------
  345-  368 (41.47/26.23)	EAE.DDKSCYFSSSGITDPNSLTSS
  371-  395 (35.76/21.59)	KAKvDNQQWSTSQSSNSDAPTDSSS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10880 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SSYENNGAVIDDSSDTSSSSNNSTGQSFSSQAERTDHSSTSPASYSHLYSPSRKLQRYQSKSPTHHALQTLLHKRTNIGETIQSRS
222
307










Molecular Recognition Features






MoRF SequenceStartStop




NANANA