<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10875
| Description |
"CLUMA_CG020258, isoform A" |
| Sequence | MAGDFWKSSHYQQWILDKQDLIRERQVDLAFLSEEEYTKVFIFFANFIQVLGEQHKLRQQVIATATVYFKRFYARNSLKNIDPFLLAPTCIFLSSKVEEFGVISANRLAGSASNLIKNKFSYAYNQEYPYHSKHILECEFYLLENLDCCLIVYQPYRPLLLLIQDIGQEDQLLTLTWRIINDSLRTDVSLLYPPHQIAIGALQIACVILQKELKHWFAELNVDMDKIQEIARAIVNLFELWKSFDEKKEIAGLLDKIPKAKPGGSSR |
| Length | 267 |
| Position | Kinase |
| Organism | Clunio marinus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Chironomoidea> Chironomidae>
Clunio.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.082 |
| Instability index | 46.90 |
| Isoelectric point | 6.32 |
| Molecular weight | 31089.60 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10875
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.40| 13| 18| 219| 231| 4
---------------------------------------------------------------------------
219- 231 (22.12/14.77) ELNVDMDKIQEIA
239- 251 (23.27/15.85) ELWKSFDEKKEIA
---------------------------------------------------------------------------
|