<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10871
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MQREEKQLEMFLDNSLIKLNDLKKAIGQMIQKIEMEHERINWPQFLDNFALISGHLAGLSKQLALEYTPQISRLTVLPLFLSPDVDEHLVQITEGRLPVFAAECVPDYLRTKPDPTMESRMNLHEAKANALTNETAAKQVAQYTKIVSHVSDLISKARDEWEIESMNRNAQMPTYSQADTHTLVKAVGMGTNLAVTGGPVGNMLIPPGPRMPGPVQMSSVSPNLPQMGKLPSSIKTNIKSASLHPYR |
Length | 247 |
Position | Head |
Organism | Clunio marinus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Chironomoidea> Chironomidae>
Clunio.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.328 |
Instability index | 32.88 |
Isoelectric point | 6.66 |
Molecular weight | 27508.47 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10871
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.40| 17| 32| 1| 17| 1
---------------------------------------------------------------------------
1- 17 (30.40/20.91) MQREEKQLEMFLDN.SLI
35- 52 (29.00/19.66) MEHERINWPQFLDNfALI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.64| 16| 18| 209| 224| 3
---------------------------------------------------------------------------
209- 224 (30.42/15.68) PRM...PGPVQMSSVSPNL
225- 243 (22.22/ 9.97) PQMgklPSSIKTNIKSASL
---------------------------------------------------------------------------
|