<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10867
| Description |
"CLUMA_CG015904, isoform A" |
| Sequence | MNNQMGMIDFQNQIVPNNNPPNQNVAPMPQLTLQTPQTPSNAIAGGPNPNTVGGSMNSQQKEFNVLSLCRVGQETVQDILSRFQDIFGILKNHQPPNGLQGSGPMSSDKRQKMQDQFRTIRLLFKRLRLLYDKCDSAEEFIQVETLIPFYDDENKPDTVPVHSEEYERAIIENRELTEVLAQKNLQLKEIIDNIRSIIWEINSMMAARKS |
| Length | 210 |
| Position | Head |
| Organism | Clunio marinus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Chironomoidea> Chironomidae>
Clunio.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.619 |
| Instability index | 55.49 |
| Isoelectric point | 5.29 |
| Molecular weight | 23926.90 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10867
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.14| 19| 74| 10| 28| 1
---------------------------------------------------------------------------
10- 28 (39.11/20.25) FQN..QIVPNNNPPN..QNVAPM
83- 105 (30.04/14.12) FQDifGILKNHQPPNglQGSGPM
---------------------------------------------------------------------------
|