<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10865

Description Eukaryotic translation initiation factor 3 subunit K
SequenceMAKLIKTDDGTLMTIPEMLKSIERYNPTHFVFLEQYVQEQAKENTYDLDANLAVLKYYQFNPLALNLNITHLILLKALTNLPFSDFVLCKYLLLPTQMRDDTVKEIIYIADILEQCDFVLFWQTVQNKGALFEKITGFYDSVRKFVCHVVGTTFQTVDKVYLSKLLGNVDDKQLTHWVKKHNWTMQGDIVTIIKQEETIKTKHIAEKIDFESLGGLMANCFSTNNNKMSVEDEVLRIHKKLSKITSSGTDNQTQALDLLKALQNLKIDLDILTSTRIGMAVNELRKCSKDEEVINLSKKLIKNWKKLLASNPESPKSSQKSSNGSSASKPSSKDSNKDDKIKDSKSKSSSQTNFPPPSSSSTTDVVRLKCREMLAGALKVEDYPDGCASAEELAEELEEAIFAEFKNTDMKYKNRIRSRVSNLKDTKNPGLRNNFITGVISASRFAKMTPEEMANDEMKKLREKFVKESINDAQLATVQGTKTDLLKCGKCKKKDCTYNQLQTRSADEPMTTFVMCNACEQGKSMSNYTRMFRGKMRTSTCRIILITSLAWLLIDVIIIMKYTDGLNGGIFKKSRDNGQQSHNVASLSGGHHVIDEDPIVDEEEIDTNLNNIDNGDEIVKRISKTYRTVDLKKWRPAPVVKENPGKPGEMGKPVKMKSYQQEEMKEKFKENQFNLLASDMIWLNRSLSDVRHKDCRTKTYPGKMPTTSIVIVFHNEAWSTLLRTIWSVINRSPRPLLKEIILVDDASEREYLGKKLEDYVQTLPVSTYVLRTGKRSGLIRARLLGAANVKGQVITFLDAHCECTEGWLEPLLSRIVLDRRTVVCPIIDVISDETFEYVTASDQTWGGFNWKLNFRWYRVPSREMSRRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRIWQCGGILEIAPCSHVGHVFRDKSPYTFPGGVANIVLKNAARVAEVWLDEWKEFYFAMSPGARKTSAGDVSGRLQLRERLQCKSFRWYLENIYPESQMPLDYYFLGEIRNAESHNCLDTMGHKSGEKVGSSYCHGLGGNQVFAYTKRQQIMSDDNCLDASNANGPVNLVRCHGMGGNQEWSYDENDLTIKHVNSGNCLTRPTKDDPSTPLLRPCNYSKGQQWLMQSKFKWQSRHGSEDEKRR
Length1157
PositionUnknown
OrganismClunio marinus
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Chironomoidea> Chironomidae> Clunio.
Aromaticity0.08
Grand average of hydropathy-0.520
Instability index42.27
Isoelectric point8.58
Molecular weight131796.11
Publications









Function






Annotated function

Component of the eukaryotic translation initiation factor 3
(eIF-3) complex, which is involved in protein synthesis of a
specialized repertoire of mRNAs and, together with other initiation
factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S
ribosome. The eIF-3 complex specifically targets and initiates
translation of a subset of mRNAs involved in cell proliferation.



ECO:0000256	HAMAP-Rule:MF_03010

GO - Cellular Component
eukaryotic 43S preinitiation complex	GO:0016282	IEA:UniProtKB-UniRule
eukaryotic 48S preinitiation complex	GO:0033290	IEA:UniProtKB-UniRule
eukaryotic translation initiation factor 3 complex	GO:0005852	IEA:UniProtKB-UniRule
Golgi membrane	GO:0000139	IEA:UniProtKB-SubCell
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
carbohydrate binding	GO:0030246	IEA:UniProtKB-KW
ribosome binding	GO:0043022	IEA:InterPro
transferase activity, transferring glycosyl groups	GO:0016757	IEA:UniProtKB-KW
translation initiation factor activity	GO:0003743	IEA:UniProtKB-UniRule
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
formation of cytoplasmic translation initiation complex	GO:0001732	IEA:UniProtKB-UniRule
protein glycosylation	GO:0006486	IEA:UniProtKB-UniPathway
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
regulation of translational initiation	GO:0006446	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10865
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.41|      28|      37|    1030|    1059|       1
---------------------------------------------------------------------------
 1030- 1059 (48.56/42.10)	NCLDTmGHKSGeKVGSSYCHGLGGNQVFAY
 1070- 1097 (58.85/40.16)	NCLDA.SNANG.PVNLVRCHGMGGNQEWSY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.48|      27|      58|     830|     856|       2
---------------------------------------------------------------------------
  830-  856 (54.12/37.76)	ISDETFEYVTASDQ...TWGGFNWKLNFR.W
  887-  917 (44.36/29.50)	IDKDYFYEIGSYDEgmdIWGGENLEMSFRiW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.38|      25|      37|     576|     602|       3
---------------------------------------------------------------------------
  576-  602 (39.99/28.82)	DNGQQshNVASLSGGHHVID.....EDPIVDE
  613-  642 (37.39/20.52)	DNGDE..IVKRISKTYRTVDlkkwrPAPVVKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     128.68|      35|      58|     207|     241|       5
---------------------------------------------------------------------------
  207-  241 (56.38/37.21)	KIDFESLGGLMANCFSTNNNKMSVEDEVLRIHKKL
  243-  265 (20.56/ 8.68)	............KITSSGTDNQTQALDLLKALQNL
  266-  300 (51.73/33.50)	KIDLDILTSTRIGMAVNELRKCSKDEEVINLSKKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.66|      23|      26|     471|     493|       8
---------------------------------------------------------------------------
  471-  493 (38.42/24.05)	NDAQLATVQGTKTDLLKCGKCKK
  499-  521 (41.24/26.33)	NQLQTRSADEPMTTFVMCNACEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.92|      17|      85|     332|     354|       9
---------------------------------------------------------------------------
  313-  329 (27.32/ 7.04)	ESPKSSQ.KSSNGSSASK
  334-  351 (23.60/25.51)	DSNKDDKiKDSKSKSSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.73|      23|      31|     111|     140|      12
---------------------------------------------------------------------------
  116-  140 (38.86/40.76)	CDFV.LFWQTVQNkgALFEKITGFYD
  147-  170 (35.87/18.16)	CHVVgTTFQTVDK..VYLSKLLGNVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.75|      10|      33|     431|     440|      13
---------------------------------------------------------------------------
  431-  440 (17.37/10.20)	LRNNFITGVI
  461-  470 (16.39/ 9.23)	LREKFVKESI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10865 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LASNPESPKSSQKSSNGSSASKPSSKDSNKDDKIKDSKSKSSSQTNFPPPSSSSTTDVV
308
366










Molecular Recognition Features






MoRF SequenceStartStop




NANANA