<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10851
Description |
"CLUMA_CG007010, isoform A" |
Sequence | MDFDFKVKTQNERTKVEDLFDYEGCKVGRGTYGHVYKGHRKEGNDNKDYALKQIEGTGLSMSACREIALLRELKHPNVINLIRVFLSHTDRKVWLLFDYAEHDLWHIIKFHRAAKAAKKPVLVPKGMVKSLLYQILDGIHYLHTNWVLHRDLKPANILVMGEGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQEKDWEDIRKMPEHNTLTKDFKRSSYASCSLVKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQAMVDEYFSESPQPTQDVFAGGPIPYPKREFLTDEEEDKSDSKRQGQAQQSQNQQQQSGNNQQGNGGNSNNDHSNSAKRPRLSGNQQQSNNQNQQQMQQEYHQSQQNQQNQMLFNQNQNNFQQRY |
Length | 452 |
Position | Kinase |
Organism | Clunio marinus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Chironomoidea> Chironomidae>
Clunio.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.857 |
Instability index | 46.83 |
Isoelectric point | 8.69 |
Molecular weight | 52585.70 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP10851
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.75| 16| 16| 365| 380| 1
---------------------------------------------------------------------------
365- 380 (29.87/14.72) DKSDS.KR...QGQAQQSQN
383- 398 (27.51/13.06) QQSGN.NQ...QGNGGNSNN
399- 418 (20.37/ 7.99) DHSNSaKRprlSGNQQQSNN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.02| 10| 22| 419| 428| 3
---------------------------------------------------------------------------
419- 428 (20.45/10.72) QNQQQMQQEY
443- 452 (20.57/10.82) QNQNNFQQRY
---------------------------------------------------------------------------
|