<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10848
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MFNNNFQNSSQVKMEISPKSSPRRIQDSSGTLKTKISLGKNPTIVHSGPFYLVKEPPEKSDLTGATNLIAHYGLEHTYSKFNSKKVKEQLSSFLPTLPCVIDGPGAIDNSSLRSVIDKPPIGGKELLPLSSVQLAGFRLHPNVPLPEKYRILNSTPTRKHKKKDKKHKYDNSITQDLSTSEQPGDTHEKKHKKGKRHDDDKERKKRKKEKKKKKQSKHSPDHPTSPMAMES |
Length | 231 |
Position | Head |
Organism | Clunio marinus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Chironomoidea> Chironomidae>
Clunio.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.128 |
Instability index | 49.49 |
Isoelectric point | 9.92 |
Molecular weight | 26049.46 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10848
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.45| 22| 42| 158| 180| 1
---------------------------------------------------------------------------
156- 178 (34.83/16.33) PtRKHKKKDKKHKYDNSITQDLS
201- 223 (32.61/10.89) KeRKKRKKEKKKKKQSKHSPDHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 121.70| 41| 87| 20| 66| 2
---------------------------------------------------------------------------
20- 66 (64.42/44.43) SSPRRIQDssgtlKTKISlGKN..P.TIVHSGPFYLVKE.P.PEKSDLTGAT
110- 155 (57.28/27.91) SSLRSVID.....KPPIG.GKEllPlSSVQLAGFRLHPNvPlPEKYRILNST
---------------------------------------------------------------------------
|