<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10846
| Description |
"CLUMA_CG002112, isoform A" |
| Sequence | MAQSKDSLLKSYNTRLKDDVKSMLENFEEIIKMAKGENEGSQLSKLTQCEQDAYEMQVRAANIVRAGESLLKLVSDIKQFLVLNDFHSVNDAISSSSSLYRATQQDRDHKLMNLRDEMAVDLYDLELEYYTGSI |
| Length | 134 |
| Position | Head |
| Organism | Clunio marinus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Chironomoidea> Chironomidae>
Clunio.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.523 |
| Instability index | 30.87 |
| Isoelectric point | 4.81 |
| Molecular weight | 15322.09 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10846
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.87| 19| 54| 41| 59| 1
---------------------------------------------------------------------------
41- 59 (33.47/21.49) SQLSKLTQCEQDAYEMQVR
97- 115 (33.40/21.43) SSLYRATQQDRDHKLMNLR
---------------------------------------------------------------------------
|